Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3)
LigandBDBM200949
Substrate/Competitorn/a
Meas. Tech.Kinase Assay (Method A)
IC50 360±n/a nM
Citation Bystrom, SHedgecock, CHoman, ELundback, TMartinsson, JSari, MFarnegardh, KJonsson, M Sulfonamide compounds US Patent US9233946 Publication Date 1/12/2016
More Info.:Get all data from this article,  Assay Method
 
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3)
Name:6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3)
Synonyms:6-phosphofructo-2-kinase | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 | 6PF-2-K/Fru-2,6-P2ase 3 | 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme | Fructose-2,6-bisphosphatase | PFK/FBPase 3 | PFKFB3 | Renal carcinoma antigen NY-REN-56 | iPFK-2
Type:Enzyme
Mol. Mass.:59620.59
Organism:Homo sapiens (Human)
Description:Q16875
Residue:520
Sequence:
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQ
IAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM200949
NameBDBM200949
Synonyms:US9233946, 48
TypeSmall organic molecule
Emp. Form.C16H14N6O2S2
Mol. Mass.386.451
SMILESCc1c(sc2ccc(N)cc12)S(=O)(=O)Nc1cccc(c1)-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a