Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoacylglycerol acyltransferase type 2 (h-MGAT2)
LigandBDBM201540
Substrate/Competitorn/a
Meas. Tech.MGAT LCMS Assay
IC50 3±n/a nM
Citation Turdi, HHangeland, JJLawrence, RMCheng, DAhmad, SMeng, WBrigance, RPDevasthale, PZhao, G Aryl dihydropyridinones and piperidinone MGAT2 inhibitors US Patent US9187424 Publication Date 11/17/2015
More Info.:Get all data from this article,  Assay Method
 
Monoacylglycerol acyltransferase type 2 (h-MGAT2)
Name:Monoacylglycerol acyltransferase type 2 (h-MGAT2)
Synonyms:Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase | Beta-1,2-N-acetylglucosaminyltransferase II | GNT-II | GlcNAc-T II | MGAT2 | Mannoside acetylglucosaminyltransferase 2 | Monoacylglycerol acyltransferase 2 (MGAT2) | N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II | h-MGAT2 (human monoacylglycerol acyltransferase type 2)
Type:n/a
Mol. Mass.:51567.80
Organism:Homo sapiens (Human)
Description:Q10469
Residue:447
Sequence:
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM201540
NameBDBM201540
Synonyms:US9187424, 307
TypeSmall organic molecule
Emp. Form.C28H25F6N5O2
Mol. Mass.577.5208
SMILESCCCCCCC#Cc1ccc(cc1F)C1(CC(=C(c2nn[nH]n2)C(=O)N1)c1ccc(OC(F)F)cc1)C(F)(F)F |t:18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a