Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpidermal growth factor receptor (EGFR) (delE756-A750)
LigandBDBM202370
Substrate/Competitorn/a
Meas. Tech.Cell Based Assay
EC50<10±n/a nM
Citation Lee, KNiu, DPetter, RCSingh, J Heteroaryl compounds and uses thereof US Patent US9238629 Publication Date 1/19/2016
More Info.:Get all data from this article,  Assay Method
 
Epidermal growth factor receptor (EGFR) (delE756-A750)
Name:Epidermal growth factor receptor (EGFR) (delE756-A750)
Synonyms:n/a
Type:n/a
Mol. Mass.:106734.86
Organism:Homo sapiens (Human)
Description:n/a
Residue:962
Sequence:
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
LLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKTSPKANKEILDEAYVMASVDNPHVCRLLGICLTST
VQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLV
KTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVW
ELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELI
IE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM202370
NameBDBM202370
Synonyms:US10081606, Compound I-2 | US9238629, I-2 | US9765038, Compound I-2
TypeSmall organic molecule
Emp. Form.C21H17F3N4O3
Mol. Mass.430.3799
SMILESCOc1ccccc1Nc1ncc(c(Oc2cccc(NC(=O)C=C)c2)n1)C(F)(F)F
Structure
n/a