Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
LigandBDBM289571
Substrate/Competitorn/a
Meas. Tech.IMAP TR-FRET assay
Temperature298.15±n/a K
EC50<100±n/a nM
Commentsextracted
Citation Branstetter, BBreitenbucher, JDyck, BGomez, LHudson, ARMarrone, TJPeters, MVickers, T Substituted thiophene- and furan-fused azolopyrimidine-5-(6H)-one compounds US Patent US10092575 Publication Date 10/9/2018
More Info.:Get all data from this article,  Assay Method
 
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
Name:Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
Synonyms:63 kDa Cam-PDE | Calcium/calmodulin-dependent 3 ,5 -cyclic nucleotide phosphodiesterase 1B | Cam-PDE 1B | PDE1B | PDE1B1 | PDES1B | Phosphodiesterase 1B | Phosphodiesterase 1B (PDE1B1) | Phosphodiesterase Type 1 (PDE1B)
Type:Enzyme
Mol. Mass.:61366.51
Organism:Homo sapiens (human)
Description:n/a
Residue:536
Sequence:
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM289571
NameBDBM289571
Synonyms:6-(4-Methoxybenzyl)-9-methyl-8-((methyl((tetrahydrofuran-3-yl)methyl)amino)methyl)thieno[3,2-e][1,2,4]triazolo[1,5-c]pyrimidin-5(6H)-one | US10092575, Example 59
TypeSmall organic molecule
Emp. Form.C23H27N5O3S
Mol. Mass.453.557
SMILESCOc1ccc(Cn2c3sc(CN(C)CC4CCOC4)c(C)c3c3ncnn3c2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a