Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetWith-No-Lysine (K) Kinase 4 (WNK4)
LigandBDBM203827
Substrate/Competitorn/a
Meas. Tech.In vitro MBP Phosphorylation Assay (MBP)
IC50 9±0.0 nM
Citation Yamada, KPark, HMRigel, DFDiPetrillo, KWhalen, EJAnisowicz, ABeil, MBerstler, JBrocklehurst, CEBurdick, DACaplan, SLCapparelli, MPChen, GChen, WDale, BDeng, LFu, FHamamatsu, NHarasaki, KHerr, THoffmann, PHu, QYHuang, WJIdamakanti, NImase, HIwaki, YJain, MJeyaseelan, JKato, MKaushik, VKKohls, DKunjathoor, VLaSala, DLee, JLiu, JLuo, YMa, FMo, RMowbray, SMogi, MOssola, FPandey, PPatel, SJRaghavan, SSalem, BShanado, YHTrakshel, GMTurner, GWakai, HWang, CWeldon, SWielicki, JBXie, XXu, LYagi, YIYasoshima, KYin, JYowe, DZhang, JHZheng, GMonovich, L Small-molecule WNK inhibition regulates cardiovascular and renal function. Nat Chem Biol12:896-898 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
With-No-Lysine (K) Kinase 4 (WNK4)
Name:With-No-Lysine (K) Kinase 4 (WNK4)
Synonyms:n/a
Type:n/a
Mol. Mass.:48305.17
Organism:Homo sapiens (Human)
Description:Q9H4A3 1-444 aa Carna Biosciences, cat no. 05-182
Residue:444
Sequence:
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM203827
NameBDBM203827
Synonyms:N-(tert-butyl)-1-(1-(5-(5-(trifluoromethyl)-1,3,4-oxadiazol- 2-yl)pyridin-2-yl)piperidin-4-yl)-1H-imidazole-5-carboxamide | WNK463 | WNK463 (2)
TypeSmall organic molecule
Emp. Form.C22H25F3N6O2
Mol. Mass.462.4681
SMILESCC(C)(C)NC(=O)c1cncn1C1CCN(CC1)c1ccc(cc1)-c1nnc(o1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a