Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBET bromodomain 4(1,2) (BRD4(1,2))
LigandBDBM205431
Substrate/Competitorn/a
Meas. Tech.Bromodomains Assay for DiscoveRx Gene Symbol
Ki 0.012±0.0 nM
Citation Tanaka, MRoberts, JMSeo, HSSouza, APaulk, JScott, TGDeAngelo, SLDhe-Paganon, SBradner, JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol12:1089-1096 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BET bromodomain 4(1,2) (BRD4(1,2))
Name:BET bromodomain 4(1,2) (BRD4(1,2))
Synonyms:n/a
Type:n/a
Mol. Mass.:29666.85
Organism:Homo sapiens (Human)
Description:O60885 (BRD4, 44-168 and 333-460)
Residue:253
Sequence:
NPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKT
PMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINE
LPTEEKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGL
HDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQ
DVFEMRFAKMPDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM205431
NameBDBM205431
Synonyms:(6S+2S)-PEG1 (7)
TypeSmall organic molecule
Emp. Form.C43H42Cl2N10O5S2
Mol. Mass.913.894
SMILESCOC(=O)C[C@@H]1N=C(c2c(C)c(sc2-n2c(C)nnc12)C(=O)NCCOCCNC(=O)C[C@@H]1N=C(c2c(C)c(C)sc2-n2c(C)nnc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 |r,c:6,36|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a