Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain testis 2 (BRDT(2))
LigandBDBM205453
Substrate/Competitorn/a
Meas. Tech.Bromodomains Assay for DiscoveRx Gene Symbol
Ki 0.086±0.0 nM
Citation Tanaka, MRoberts, JMSeo, HSSouza, APaulk, JScott, TGDeAngelo, SLDhe-Paganon, SBradner, JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol12:1089-1096 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain testis 2 (BRDT(2))
Name:Bromodomain testis 2 (BRDT(2))
Synonyms:n/a
Type:n/a
Mol. Mass.:15596.28
Organism:Homo sapiens (Human)
Description:Q58F21 (BRDT, 251-382)
Residue:132
Sequence:
KNVLPDSQQQYNVVKTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYY
DVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVTMARMLQDVFE
THFSKIPIEPVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM205453
NameBDBM205453
Synonyms:MTI (35)
TypeSmall organic molecule
Emp. Form.C54H66Cl2N10O9S2
Mol. Mass.1134.199
SMILESCc1sc-2c(c1C)C(=NC(CC(=O)NCCOCCOCCOCCOCCOCCOCCOCCNC(=O)C[C@@H]1N=C(c3c(C)c(C)sc3-n3c(C)nnc13)c1ccc(Cl)cc1)c1nnc(C)n-21)c1ccc(Cl)cc1 |r,c:8,43|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a