Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBET bromodomain 4 (BRD4)
LigandBDBM50380682
Substrate/Competitorn/a
Meas. Tech.AlphaScreen BRD Binding Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 29.4±0.0 nM
Commentsextracted
Citation Tanaka, MRoberts, JMSeo, HSSouza, APaulk, JScott, TGDeAngelo, SLDhe-Paganon, SBradner, JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol12:1089-1096 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BET bromodomain 4 (BRD4)
Name:BET bromodomain 4 (BRD4)
Synonyms:n/a
Type:n/a
Mol. Mass.:80477.46
Organism:Homo sapiens (Human)
Description:O60885-2
Residue:722
Sequence:
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETG
PA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380682
NameBDBM50380682
Synonyms:CHEMBL2017291 | I-BET151 (16)
TypeSmall organic molecule
Emp. Form.C23H21N5O3
Mol. Mass.415.4445
SMILESCOc1cc2c3n([C@H](C)c4ccccn4)c(=O)[nH]c3cnc2cc1-c1c(C)noc1C |r,wD:7.7,(46.55,-39.62,;46.55,-41.16,;47.89,-41.93,;49.21,-41.16,;50.55,-41.92,;51.88,-41.15,;52.18,-39.65,;51.41,-38.32,;49.87,-38.32,;52.18,-36.98,;51.41,-35.66,;52.17,-34.32,;53.72,-34.32,;54.49,-35.66,;53.72,-36.99,;53.7,-39.47,;54.46,-38.13,;54.34,-40.87,;53.21,-41.9,;53.22,-43.46,;51.89,-44.23,;50.55,-43.47,;49.22,-44.25,;47.88,-43.47,;46.55,-44.24,;46.51,-45.79,;47.74,-46.72,;45.04,-46.23,;44.16,-44.97,;45.09,-43.74,;44.64,-42.27,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a