Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInorganic pyrophosphatase (EcPPiase)
LigandBDBM205474
Substrate/Competitorn/a
Meas. Tech.Colorimetric Malachite Green Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 6.8e+4± 8e+3 nM
Commentsextracted
Citation Pang, AHGarzan, ALarsen, MJMcQuade, TJGarneau-Tsodikova, STsodikov, OV Discovery of Allosteric and Selective Inhibitors of Inorganic Pyrophosphatase from Mycobacterium tuberculosis. ACS Chem Biol11:3084-3092 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inorganic pyrophosphatase (EcPPiase)
Name:Inorganic pyrophosphatase (EcPPiase)
Synonyms:n/a
Type:Protein
Mol. Mass.:19696.77
Organism:Escherichia coli (Enterobacteria)
Description:P0A7A9
Residue:176
Sequence:
MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYIN
HTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDH
IKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM205474
NameBDBM205474
Synonyms:PPiase inhibitor, 18
TypeSmall organic molecule
Emp. Form.C29H42N6
Mol. Mass.474.684
SMILESCCCCN(CCCC)c1nc(nc(n1)-c1cccn1-c1cc(C)cc(C)c1)N1CCCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a