Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 1
LigandBDBM206151
Substrate/Competitorn/a
Meas. Tech.In vitro IRAK-1 and IRAK-4 Assay
IC50 800±n/a nM
Citation Arora, NChen, SHermann, JCKuglstatter, ALabadie, SSLin, CJLucas, MCMoore, AGPapp, ETalamas, FXWanner, JZhai, Y Pyrazolo[1,5a]pyrimidine derivatives as IRAK4 modulators US Patent US9255110 Publication Date 2/9/2016
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 1
Name:Interleukin-1 receptor-associated kinase 1
Synonyms:IRAK | IRAK-1 | IRAK1 | Interleukin-1 receptor-associated kinase 1 (IRAK-1)
Type:Enzyme
Mol. Mass.:76536.81
Organism:Homo sapiens (Human)
Description:P51617
Residue:712
Sequence:
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM206151
NameBDBM206151
Synonyms:US9255110, 64
TypeSmall organic molecule
Emp. Form.C19H20ClN5OS
Mol. Mass.401.913
SMILESNCC1CCN(CC1)c1ccc(Cl)cc1NC(=O)c1csc2cncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a