Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor 1
LigandBDBM208519
Substrate/Competitorn/a
Meas. Tech.Antagonistic Activity Assay
IC50 0.8±n/a nM
Citation Futamura, AAraki, YAbe, MOhta, HSuzuki, RNozawa, D Heteroaromatic methyl cyclic amine derivative US Patent US9266870 Publication Date 2/23/2016
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor 1
Name:Orexin receptor 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM208519
NameBDBM208519
Synonyms:US9266870, 35
TypeSmall organic molecule
Emp. Form.C24H23FN6O2
Mol. Mass.446.4768
SMILESCc1ccc(c(c1)C(=O)N1CCCOC1Cn1cc(cn1)-c1ccc(F)cc1)-n1nccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a