Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 9 (CA IX)
LigandBDBM210936
Substrate/Competitorn/a
Meas. Tech.CA Inhibition Assay
Ki 20±0.0 nM
Citation Bhatt, AMahon, BPCruzeiro, VWCornelio, BLaronze-Cochard, MCeruso, MSapi, JRance, GAKhlobystov, ANFontana, ARoitberg, ASupuran, CTMcKenna, R Structure-Activity Relationships of Benzenesulfonamide-Based Inhibitors towards Carbonic Anhydrase Isoform Specificity. Chembiochem18:213-222 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 9 (CA IX)
Name:Carbonic anhydrase 9 (CA IX)
Synonyms:n/a
Type:Protein
Mol. Mass.:29162.54
Organism:Homo sapiens (Human)
Description:Chimeric protein of CA II with 7 mutations (A65S, N67Q, E69T, I91L, F131V, K170E, L204A); 5sZ4, 5SZ5, 5SZ6, 5SZ7
Residue:260
Sequence:
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRIL
NNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHL
VHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDP
RGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELM
VDNWRPAQPLKNRQIKASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM210936
NameBDBM210936
Synonyms:4-(2-methylphenyl)-bezenesulfonamide (4b)
TypeSmall organic molecule
Emp. Form.C13H13NO2S
Mol. Mass.247.313
SMILESCc1ccccc1-c1ccc(cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a