Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase/FLAP
LigandBDBM165132
Substrate/Competitorn/a
Meas. Tech.FLAP Binding Assay
Ki 17±n/a nM
Citation Chai, WDeckhut, CDvorak, CAEccles, WEdwards, JPGoldberg, SDKrawczuk, PJLebsack, ADLiu, JTanis, VMTarantino, KT 1,2,5-Substituted benzimidazoles as flap modulators US Patent US9682971 Publication Date 6/20/2017
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase/FLAP
Name:5-lipoxygenase/FLAP
Synonyms:5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein
Type:Enzyme
Mol. Mass.:18159.90
Organism:Homo sapiens (Human)
Description:P20292
Residue:161
Sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM165132
NameBDBM165132
Synonyms:US9067917, 167 | US9682971, 167
TypeSmall organic molecule
Emp. Form.C32H28N4O3S
Mol. Mass.548.655
SMILESCC(C)(Cc1nc2cc(OCc3ccc4ccccc4n3)ccc2n1Cc1cccc(c1)-c1cncs1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a