Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCD63 antigen
LigandBDBM212273
Substrate/Competitorn/a
Meas. Tech.High Throughput Syk Biochemical Assay
pH7±n/a
IC50 157±n/a nM
Commentsextracted
Citation Blomgren, PACurrie, KSKropf, JELee, SHLo, JRMitchell, SASchmitt, ACXiong, JXu, JZhao, ZSwaminathan, S Substituted imidazo[1,2-a]pyrazines as Syk inhibitors US Patent US9290505 Publication Date 3/22/2016
More Info.:Get all data from this article,  Assay Method
 
CD63 antigen
Name:CD63 antigen
Synonyms:CD_antigen: CD63 | Granulophysin | LAMP-3 | Lysosomal-associated membrane protein 3 | MLA1 | Melanoma-associated antigen ME491 | OMA81H | Ocular melanoma-associated antigen | TSPAN30 | Tetraspanin-30 | Tspan-30
Type:n/a
Mol. Mass.:25640.41
Organism:Homo sapiens (Human)
Description:n/a
Residue:238
Sequence:
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM212273
NameBDBM212273
Synonyms:6-(6-aminopyrazin-2-yl)-5-methyl-N-(4-(4-(oxetan-3-yl)piperazin-1-yl)phenyl)imidazo[1,2-a]pyrazin-8-amine | US9290505, Ex.-4 | US9504684, Ex.-4
TypeSmall organic molecule
Emp. Form.C24H27N9O
Mol. Mass.457.5309
SMILESCc1c(nc(Nc2ccc(cc2)N2CCN(CC2)C2COC2)c2nccn12)-c1cncc(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a