Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1)
LigandBDBM213229
Substrate/Competitorn/a
Meas. Tech.Isothermal Titration Calorimetry (ITC)
pH7.5±0
Temperature298.15±0 K
Kd 2.688e+4± 0 nM
Citation Gosein, VMiller, GJ Roles of phosphate recognition in inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) substrate binding and activation. J Biol Chem288:26908-13 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1)
Name:Inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:50507.86
Organism:Arabidopsis thaliana (Mouse-ear cress)
Description:Q93YN9
Residue:451
Sequence:
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNANGVVSV
LTSDEQHLWRENNELISSPNKEVLEQRYVKNVIIPLLGPKHVDAGVRVSVSKEFLECVDK
KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGISSGGDCISVEIKPKCGFLPTSRFI
GKENMLKTSVSRFKMHQLLKLEYNEISEESEYDPLDLFSGSKESVLEAIKALYSTPQNNF
RVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGV
LDRLLEIQKLDKLDIEGAIHSYYDLINQPCPICKEGKPLEAELSLHALPLDESLKIVKEY
LIAATAKDCSIMISFQSRNAWDSEPSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYY
KLDKKIISFYNRKQKAENTAEQIGNSKPSHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM213229
NameBDBM213229
Synonyms:1,3,4,6-Inositol tetrakisphosphate (1,3,4,6-IP4)
TypeSmall organic molecule
Emp. Form.C6H8O18P4
Mol. Mass.492.0164
SMILESO[C@H]1[C@H](OP([O-])([O-])=O)[C@@H](OP([O-])([O-])=O)[C@@H](O)[C@@H](OP([O-])([O-])=O)[C@@H]1OP([O-])([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a