Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaseinolytic protein C1 (ClpC1 NTD-D1)
LigandBDBM213240
Substrate/Competitorn/a
Meas. Tech.Isothermal Titration Calorimetry (ITC)
pH7.5±0
Temperature298.15±0 K
Kd 19.2±5.2 nM
Citation Vasudevan, DRao, SPNoble, CG Structural basis of mycobacterial inhibition by cyclomarin A J Biol Chem288:30883-91 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Caseinolytic protein C1 (ClpC1 NTD-D1)
Name:Caseinolytic protein C1 (ClpC1 NTD-D1)
Synonyms:n/a
Type:Protein
Mol. Mass.:54272.48
Organism:Mycobacterium tuberculosis
Description:M. tuberculosis ClpC1 N-terminal domain D1 (1-493 aa)
Residue:493
Sequence:
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR
SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA
AAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE
TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG
AIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILK
GLRDRYEAHHRVSITDAAMVAAATLADRYINDRFLPDKAIDLIDEAGARMRIRRMTAPPD
LREFDEKIAEARREKESAIDAQDFEKAASLRDREKTLVAQRAEREKQWRSGDLDVVAEVD
DEQIAEVLGNWTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM213240
NameBDBM213240
Synonyms:Cyclomarin A1 (CymA1)
TypeSmall organic molecule
Emp. Form.C59H92N10O11
Mol. Mass.1117.4222
SMILES[#6]-[#8]-[#6@@H](-[#6@@H]-1-[#7]-[#6](=O)-[#6@H](-[#6])-[#7]-[#6](=O)-[#6@H](-[#6]-[#6@@H](-[#6])-[#6]-[#8])-[#7](-[#6])-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#6])-[#6])-[#7](-[#6])-[#6](=O)-[#6@@H](-[#7]-[#6]-1=O)-[#6](-[#6])-[#6])-[#6@H](-[#6])\[#6]=[#6](/[#6])-[#6])-[#6@H](-[#8])-c1cn(c2ccccc12)C([#6])([#6])[#6@@H](-[#8])-[#6]-[#7]-[#6]-[#6]-[#6]-[#7])-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a