Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrganic anion-transporting polypeptide 1D1 (Oatp1d1)
LigandBDBM50170653
Substrate/Competitorn/a
Meas. Tech.Oatp1d1 Transport Assay
Ki 1.05e+5± 0 nM
Citation Popovic, MZaja, RFent, KSmital, T Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide. J Biol Chem288:33894-911 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Organic anion-transporting polypeptide 1D1 (Oatp1d1)
Name:Organic anion-transporting polypeptide 1D1 (Oatp1d1)
Synonyms:n/a
Type:Protein
Mol. Mass.:75011.81
Organism:Danio rerio (Zebrafish)
Description:n/a
Residue:689
Sequence:
MSTEKKKEPCCSKLKMFLAAMCFVFFAKAFQGSYMKSSVTQIERRFDVPSSLIGFIDGSF
EIGNLFVIAFVSYFGAKLHRPRLIAAGCLVMSAGSFITAMPHFFQGQYKYESTISHFSAS
VNGTENVLPCLTNASLAQDSEIPTVESQAECEKASSSSLWLFVFLGNMLRGIGETPVMPL
GLSYLDDFSREENTAFYLALIQTVGIMGPMFGFMLGSFCAKLYVDIGTVDLDSITINYKD
SRWVGAWWLGFLVTGGVMLLAGIPFWFLPKSLTRQGEPESEKKPGAPEGGEQERFIPDNN
KHNPPASKPAPVTMSALAKDFLPSLKKLFSNTIYVLLVCTGLIQVSGFIGMITFKPKFME
QVYGQSASRAIFLIGIMNLPAVALGIVTGGFIMKRFKVNVLGAAKICIVASVLAFCSMLI
QYFLQCDNSQVAGLTVTYQGAPEVSYQTETLISQCNIGCSCSLKHWDPICASNGVTYTSP
CLAGCQTSTGIGKEMVFHNCSCIGEALLPYTNMSAVLGQCPRKSDCDFMFKIYMAVTVIG
AFFSAVGATPGYIILLRSITPELKSLALGMHTLIVRTLGGIPPPIYFGALIDKTCLKWGL
KQCGGRGACRIYDSGAFRNAFLGLIYALYSSSYLLFGLLYNRLSHREKKQALKDQLKAPE
QDSCGVSTTNGNASSAIVKCENPDQETTI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170653
NameBDBM50170653
Synonyms:(11beta)-11,21-dihydroxypregn-4-ene-3,20-dione | 11beta,21-dihydroxypregn-4-ene-3,20-dione | 11beta,21-dihydroxyprogesterone | 17-deoxycortisol | CHEMBL110739 | corticosterone
TypeSmall organic molecule
Emp. Form.C21H30O4
Mol. Mass.346.4605
SMILESC[C@]12C[C@H](O)[C@H]3[C@@H](CCC4=CC(=O)CC[C@]34C)[C@@H]1CC[C@@H]2C(=O)CO |r,t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50170653
Synonyms:(11beta)-11,21-dihydroxypregn-4-ene-3,20-dione | 11beta,21-dihydroxypregn-4-ene-3,20-dione | 11beta,21-dihydroxyprogesterone | 17-deoxycortisol | CHEMBL110739 | corticosterone
TypeSmall organic molecule
Emp. Form.C21H30O4
Mol. Mass.346.4605
SMILESC[C@]12C[C@H](O)[C@H]3[C@@H](CCC4=CC(=O)CC[C@]34C)[C@@H]1CC[C@@H]2C(=O)CO |r,t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: