Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLactoperoxidase (LPO)
LigandBDBM217356
Substrate/Competitorn/a
Meas. Tech.LPO/TPO Selectivity Assay
IC50 2.00e+3± 4e+1 nM
Citation Forbes, LVSjögren, TAuchère, FJenkins, DWThong, BLaughton, DHemsley, PPairaudeau, GTurner, REriksson, HUnitt, JFKettle, AJ Potent reversible inhibition of myeloperoxidase by aromatic hydroxamates. J Biol Chem288:36636-47 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lactoperoxidase (LPO)
Name:Lactoperoxidase (LPO)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:80659.97
Organism:Bos taurus (Bovine)
Description:P80025
Residue:712
Sequence:
MWVCLQLPVFLASVTLFEVAASDTIAQAASTTTISDAVSKVKIQVNKAFLDSRTRLKTTL
SSEAPTTQQLSEYFKHAKGRTRTAIRNGQVWEESLKRLRRDTTLTNVTDPSLDLTALSWE
VGCGAPVPLVKCDENSPYRTITGDCNNRRSPALGAANRALARWLPAEYEDGLALPFGWTQ
RKTRNGFRVPLAREVSNKIVGYLDEEGVLDQNRSLLFMQWGQIVDHDLDFAPETELGSNE
HSKTQCEEYCIQGDNCFPIMFPKNDPKLKTQGKCMPFFRAGFVCPTPPYQSLAREQINAV
TSFLDASLVYGSEPSLASRLRNLSSPLGLMAVNQEAWDHGLAYLPFNNKKPSPCEFINTT
ARVPCFLAGDFRASEQILLATAHTLLLREHNRLARELKKLNPHWNGEKLYQEARKILGAF
IQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFTFAFRFGHMEVPSTVSRLDE
NYQPWGPEAELPLHTLFFNTWRIIKDGGIDPLVRGLLAKKSKLMNQDKMVTSELRNKLFQ
PTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDL
YKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWENPGVFTEKQRDS
LQKVSFSRLICDNTHITKVPLHAFQANNYPHDFVDCSTVDKLDLSPWASREN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM217356
NameBDBM217356
Synonyms:2-(benzylamino)-6-oxo-3H-pyrimidine-5-carbohydroxamic acid (HX3)
TypeSmall organic molecule
Emp. Form.C12H12N4O3
Mol. Mass.260.2487
SMILESONC(=O)c1c[nH]c(NCc2ccccc2)nc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a