Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetL-6-hydroxynicotine oxidase (LHNO Y311F)
LigandBDBM217378
Substrate/Competitorn/a
Meas. Tech.Steady-State Kinetic Assay
pH8±0
Temperature571.3±0 K
Kd 9.6e+4± 1.8e+4 nM
Citation Fitzpatrick, PFChadegani, FZhang, SDougherty, V Mechanism of Flavoprotein l-6-Hydroxynicotine Oxidase: pH and Solvent Isotope Effects and Identification of Key Active Site Residues. Biochemistry56:869-875 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
L-6-hydroxynicotine oxidase (LHNO Y311F)
Name:L-6-hydroxynicotine oxidase (LHNO Y311F)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:46301.21
Organism:Arthrobacter nicotinovorans
Description:A. nicotinovorans LHNO Y311F mutant
Residue:425
Sequence:
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYL
HRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLR
DAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWM
LQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTV
KDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIE
CVGDGIFPTLFDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHD
WIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVN
AILHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM217378
NameBDBM217378
Synonyms:(S)-6-hydroxynicotine | 5-[(2S)-1-methylpyrrolidin-2-yl]-1H-pyridin-2-one
TypeSmall organic molecule
Emp. Form.C10H14N2O
Mol. Mass.178.231
SMILESCN1CCC[C@H]1c1ccc(=O)[nH]c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a