Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium channel protein TASK-1
LigandBDBM218405
Substrate/Competitorn/a
Meas. Tech.TASK-1 Inhibiition Assay
IC50 25±n/a nM
Citation Bialy, LLorenz, KWirth, KSteinmeyer, KHessler, G Fused pyrroledicarboxamides and their use as pharmaceuticals US Patent US9284333 Publication Date 3/15/2016
More Info.:Get all data from this article,  Assay Method
 
Potassium channel protein TASK-1
Name:Potassium channel protein TASK-1
Synonyms:Acid-sensitive potassium channel TASK-1 | Acid-sensitive potassium channel protein TASK-1 | KCNK3 | Potassium channel subfamily K member 3 | Potassium channel subfamily K member 3 (TASK-1) | TASK | TASK1 | TWIK-related acid-sensitive K(+) channel 1 | Two pore K(+) channel KT3.1 | Two pore potassium channel KT3.1
Type:Protein
Mol. Mass.:43534.71
Organism:Homo sapiens (Human)
Description:O14649
Residue:394
Sequence:
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM218405
NameBDBM218405
Synonyms:US9284333, 16fc
TypeSmall organic molecule
Emp. Form.C24H31N3O3
Mol. Mass.409.5212
SMILESCC[C@@H](NC(=O)c1cc(C(=O)N2CCC[C@@H]2CC)n2CCOCc12)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a