Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Lipoxygenase
LigandBDBM50328678
Substrate/Competitorn/a
Meas. Tech.Colorimetric 5-LO Assay
IC50 2.12e+5± 0 nM
Citation Richardson-Sanchez, TTieu, WCodd, R Reverse Biosynthesis: Generating Combinatorial Pools of Drug Leads from Enzyme-Mediated Fragmentation of Natural Products. Chembiochem18:368-373 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-Lipoxygenase
Name:5-Lipoxygenase
Synonyms:5-Lipoxygenase (5-LO)
Type:Enzyme
Mol. Mass.:97294.59
Organism:Solanum tuberosum (potato)
Description:n/a
Residue:864
Sequence:
MNIGQIMGGRELFGGHDDSKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQLI
SSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNT
HINEFFLKSLTLEDVPNHGKVHFDCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYR
ENELLTLRGDGTGKREAWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGR
PPTRTDPKSESRIPLLLSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGT
PNEFDSFEDVLRLYEGGIKLPQGPLFKALTAAIPLEMIKELLRTDGEGILRFPTPLVIKD
SKTAWRTDEEFAREMLAGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGL
TVDEAMNNNKLFILNHHDLLIPYLRRINTTITKSYASRTLLFLQDNGSLKPLAIELSLPH
PDGDQFGVTSKVYTPSDQGVESSIWQLAKAYVAVNDAGVHQLISHWLNTHAVIEPFVIAT
NRQLSVLHPIHKLLYPHFRDTMNINASARQILINAGGVLESTVFQSKFALEMSAVVYKDW
VFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYG
SDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVN
FGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEIL
SRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNA
PYTLLFPTSEGGLTGKGIPNSVSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50328678
NameBDBM50328678
Synonyms:6-(1,3-Dioxo-1H,3H-benzo[de]isoquinolin-2-yl)-hexanoic acid hydroxyamide | 6-(1,3-dioxo-1H-benzo[de]isoquinolin-2(3H)-yl)-N-hydroxyhexanamide | CHEMBL96051 | GNF-Pf-2024 | Scriptaid | Scriptaid, 9
TypeSmall organic molecule
Emp. Form.C18H18N2O4
Mol. Mass.326.3465
SMILESONC(=O)CCCCCN1C(=O)c2cccc3cccc(C1=O)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a