Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 (BRD4)
LigandBDBM220660
Substrate/Competitorn/a
Meas. Tech.Bromodomain Domain Binding Assay
pH6±n/a
Temperature298.15±n/a K
Ki 0.83±n/a nM
Commentsextracted
Citation Wang, LPratt, JKMcDaniel, KFDai, YFidanze, SDHasvold, LHolms, JHKati, WMLiu, DMantei, RAMcClellan, WJSheppard, GSWada, CK Bromodomain inhibitors US Patent US9296741 Publication Date 3/29/2016
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 (BRD4)
Name:Bromodomain-containing protein 4 (BRD4)
Synonyms:Bromodomain-containing protein 4 (BRD4-BD2)
Type:Enzyme
Mol. Mass.:12432.37
Organism:Homo sapiens (Human)
Description:BD2: amino acids E352-M457 bromodomains of human BRD4
Residue:106
Sequence:
EQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEARE
YRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM220660
NameBDBM220660
Synonyms:US9296741, 249
TypeSmall organic molecule
Emp. Form.C18H19N3O4S
Mol. Mass.373.426
SMILESCn1cc(-c2cc(ccc2OCC2CC2)S(N)(=O)=O)c2cc[nH]c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a