Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArginase-2, mitochondrial
LigandBDBM290366
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay of Arginase
pH7.4±n/a
Temperature298.15±n/a K
IC50>5000±n/a nM
Commentsextracted
Citation Van Zandt, MJagdmann, GE Arginase inhibitors as therapeutics US Patent US10098902 Publication Date 10/16/2018
More Info.:Get all data from this article,  Assay Method
 
Arginase-2, mitochondrial
Name:Arginase-2, mitochondrial
Synonyms:ARG2 | Arginase II | Kidney-type arginase | Non-hepatic arginase | Type II arginase
Type:PROTEIN
Mol. Mass.:38576.93
Organism:Homo sapiens
Description:ChEMBL_978892
Residue:354
Sequence:
MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM290366
NameBDBM290366
Synonyms:(1S,2R)-1-amino-2-(3-boronopropyl)cyclopentanecarboxylic acid | US10098902, Example 2
TypeSmall organic molecule
Emp. Form.C9H18BNO4
Mol. Mass.215.055
SMILESN[C@]1(CCC[C@H]1CCCB(O)O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a