Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 1
LigandBDBM251677
Substrate/Competitorn/a
Meas. Tech.In Vitro LPA1 Receptor Assay
Temperature298.15±n/a K
IC50 4.00±n/a nM
Commentsextracted
Citation Buffham, WCanning, HDavenport, RFarnaby, WMack, SParmar, AWright, S Amide derivatives as lysophosphatidic acid receptor antagonists US Patent US10100018 Publication Date 10/16/2018
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 1
Name:Lysophosphatidic acid receptor 1
Synonyms:LPA receptor 1 | LPA-1 | LPAR1 | Lysophosphatidic acid receptor 1 (LPA1) | Lysophosphatidic acid receptor Edg-2
Type:Enzyme
Mol. Mass.:41120.55
Organism:Homo sapiens (Human)
Description:Q92633
Residue:364
Sequence:
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM251677
NameBDBM251677
Synonyms:US10100018, Example 13 | US9464060, 13
TypeSmall organic molecule
Emp. Form.C29H24FNO5
Mol. Mass.485.503
SMILESCOc1cccc(CN(Cc2ccc(cc2)C(O)=O)C(=O)c2ccc(Oc3ccccc3F)cc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a