Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
LigandBDBM223028
Substrate/Competitorn/a
Meas. Tech.MKNK1 Kinase Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 5±n/a nM
Commentsextracted
Citation Eis, KPuehler, FZorn, LScholz, ALienau, PGnoth, MJBömer, UGünther, J Substituted imidazopyridazines US Patent US9320737 Publication Date 4/26/2016
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
Name:MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
Synonyms:MAP kinase signal-integrating kinase 1 (MNK1) (T344D) | MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1) (T344D) | MNK1a
Type:Protein
Mol. Mass.:47416.00
Organism:Homo sapiens (Human)
Description:Q9BUB5-2 with T344D
Residue:424
Sequence:
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKGIAHRDLKPENILCES
PEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKR
CDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWA
HISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPDPQVLQRNSSTMDLTLF
AAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSP
PTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223028
NameBDBM223028
Synonyms:US9320737, III.1
TypeSmall organic molecule
Emp. Form.C18H17N3O4S
Mol. Mass.371.41
SMILESCS(=O)(=O)CCCOc1ccc2ncc(-c3cc4ccccc4o3)n2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a