Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-ACP reductase (FabI1)
LigandBDBM97445
Substrate/Competitorn/a
Meas. Tech.Inhibition Kinetics Assay
pH8±0
Temperature298.15±0 K
Ki 15±0 nM
Citation Neckles, CEltschkner, SCummings, JEHirschbeck, MDaryaee, FBommineni, GRZhang, ZSpagnuolo, LYu, WDavoodi, SSlayden, RAKisker, CTonge, PJ Rationalizing the Binding Kinetics for the Inhibition of the Burkholderia pseudomallei FabI1 Enoyl-ACP Reductase. Biochemistry56:1865-1878 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-ACP reductase (FabI1)
Name:Enoyl-ACP reductase (FabI1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:27824.56
Organism:Burkholderia pseudomallei
Description:Q3JG55
Residue:253
Sequence:
MRLQHKRGLIIGIANENSIAFGCARVMREQGAELALTYLNEKAEPYVRPLAQRLDSRLVV
PCDVREPGRLEDVFARIAQEWGQLDFVLHSIAYAPKEDLHRRVTDCSQAGFAMAMDVSCH
SFIRVARLAEPLMTNGGCLLTVTFYGAERAVEDYNLMGPVKAALEGSVRYLAAELGPRRI
RVHALSPGPLKTRAASGIDRFDALLERVRERTPGHRLVDIDDVGHVAAFLASDDAAALTG
NVEYIDGGYHVVG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM97445
NameBDBM97445
Synonyms:PT119
TypeSmall molecule
Emp. Form.C19H21NO2
Mol. Mass.295.3755
SMILESCCCCCCc1ccc(Oc2ccccc2C#N)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a