Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium/calmodulin- dependent protein kinase IV (CAMKIV)
LigandBDBM223207
Substrate/Competitorn/a
Meas. Tech.Molecular Docking
Ki 1449.28±39.91 nM
Citation Jameel, ENaz, HKhan, PTarique, MKumar, JMumtazuddin, SAhamad, SIslam, AAhmad, FHoda, NHassan, MI Design, synthesis, and biological evaluation of pyrimidine derivatives as potential inhibitors of human calcium/calmodulin-dependent protein kinase IV. Chem Biol Drug Des89:741-754 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcium/calmodulin- dependent protein kinase IV (CAMKIV)
Name:Calcium/calmodulin- dependent protein kinase IV (CAMKIV)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:39277.89
Organism:Homo sapiens (Human)
Description:PDB 2W4O used as reference
Residue:349
Sequence:
MHHHHHHSSGVDLGTENLYFQSMSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESE
LGRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETP
TEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLL
YATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIIT
YILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTT
FQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223207
NameBDBM223207
Synonyms:4-Methyl-7-((6-(quinolin-8-yloxy)pyrimidin-4-yl)oxy)-2H-chromen-2one (Molecule 4)
TypeSmall organic molecule
Emp. Form.C23H15N3O4
Mol. Mass.397.3829
SMILESCc1cc(=O)oc2cc(Oc3cc(Oc4cccc5cccnc45)ncn3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a