Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-secretase 1 (BACE1)
LigandBDBM223337
Substrate/Competitorn/a
Meas. Tech.BACE1 Cell-Free Assay
pH4.5±n/a
Temperature310.15±n/a K
IC50 81±n/a nM
Commentsextracted
Citation Brodney, MABeck, EMButler, CRZhang, LO'Neill, BTBarreiro, GLaChapelle, EARogers, BN 2-amino-6-methyl-4,4a,5,6-tetrahydropyrano[3,4-d][1,3]thiazin-8a(8H)-yl-1,3-thiazol-4-yl amides US Patent US9315520 Publication Date 4/19/2016
More Info.:Get all data from this article,  Assay Method
 
Beta-secretase 1 (BACE1)
Name:Beta-secretase 1 (BACE1)
Synonyms:n/a
Type:Protein
Mol. Mass.:48152.67
Organism:Homo sapiens (Human)
Description:P56817-4
Residue:432
Sequence:
MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSL
WYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSI
KAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRP
VEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTA
AVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWCCLRCLRQQ
HDDFADDISLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223337
NameBDBM223337
Synonyms:US9315520, 24 | US9605007, Example 24 | US9744173, Example 24
TypeSmall organic molecule
Emp. Form.C16H20N6O2S2
Mol. Mass.392.499
SMILESC[C@H]1C[C@H]2CSC(N)=N[C@]2(CO1)c1nc(NC(=O)c2ccn(C)n2)cs1 |r,c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a