Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target26S Proteasome regulatory subunit Rpn11 (Rpn11)
LigandBDBM224012
Substrate/Competitorn/a
Meas. Tech.In Vitro Rpn11 Activity Assay
pH7.5±0
Temperature303.15±0 K
IC50 3.4e+2± 0 nM
Citation Li, JYakushi, TParlati, FMackinnon, ALPerez, CMa, YCarter, KPColayco, SMagnuson, GBrown, BNguyen, KVasile, SSuyama, ESmith, LHSergienko, EPinkerton, ABChung, TDYPalmer, AEPass, IHess, SCohen, SMDeshaies, RJ Capzimin is a potent and specific inhibitor of proteasome isopeptidase Rpn11. Nat Chem Biol13:486-493 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
26S Proteasome regulatory subunit Rpn11 (Rpn11)
Name:26S Proteasome regulatory subunit Rpn11 (Rpn11)
Synonyms:PSMD14 protein
Type:Protein
Mol. Mass.:34576.68
Organism:Homo sapiens (Human)
Description:O00487
Residue:310
Sequence:
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM224012
NameBDBM224012
Synonyms:Capzimin
TypeSmall organic molecule
Emp. Form.C15H13N3OS2
Mol. Mass.315.413
SMILESSc1cccc2cc(cnc12)C(=O)NCCc1nccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a