Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 1A
LigandBDBM26197
Substrate/CompetitorUS9333197, Phenacetin
Meas. Tech.Inhibition Assay
IC50>25000±n/a nM
Citation Notte, G Apoptosis signal-regulating kinase inhibitor US Patent US9333197 Publication Date 5/10/2016
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 1A
Name:Cytochrome P450 1A
Synonyms:CYPIA2 | Cytochrome P450 1A2 | Cytochrome P450 1A2 (CYP1A2)
Type:Enzyme
Mol. Mass.:58310.23
Organism:Homo sapiens (Human)
Description:n/a
Residue:515
Sequence:
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARRFSIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26197
NameBDBM26197
Synonyms:CHEMBL112 | N-(4-hydroxyphenyl)acetamide | Norco | Paracetamol | US9333197, Acetaminophen | acetaminophen | phenol derivative, 11
TypeSmall organic molecule
Emp. Form.C8H9NO2
Mol. Mass.151.1626
SMILESCC(=O)Nc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
US9333197, Phenacetin
NameBDBM50420191
Synonyms:ACETPHENETIDIN | Acetophenetidin | PHENACETIN
TypeSmall organic molecule
Emp. Form.C10H13NO2
Mol. Mass.179.2157
SMILESCCOc1ccc(NC(C)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: