Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivin receptor-like kinase 3 (ALK-3)
LigandBDBM111122
Substrate/Competitorn/a
Meas. Tech.ALK1-6 enzymatic assays
pH7.5±n/a
IC50 864±n/a nM
Commentsextracted
Citation Alimardanov, ACuny, GDGrewal, GSLee, AMcKew, JCMohedas, AHShen, MXu, XYu, PB BMP inhibitors and methods of use thereof US Patent US9682983 Publication Date 6/20/2017
More Info.:Get all data from this article,  Assay Method
 
Activin receptor-like kinase 3 (ALK-3)
Name:Activin receptor-like kinase 3 (ALK-3)
Synonyms:BMPR1A | Bone morphogenetic protein receptor type-1A
Type:Enzyme
Mol. Mass.:60204.46
Organism:Homo sapiens (Human)
Description:P36894
Residue:532
Sequence:
MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYC
KSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM111122
NameBDBM111122
Synonyms:US9682983, 1 | US9682983, 17
TypeSmall organic molecule
Emp. Form.C24H21N7
Mol. Mass.407.4704
SMILESC1CN(CCN1)c1ccc(cn1)-c1cnc2c(cnn2c1)-c1ccnc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a