Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase receptor R3
LigandBDBM161920
Substrate/Competitorn/a
Meas. Tech.ALK1-6 enzymatic assays
pH7.5±n/a
IC50 30±n/a nM
Commentsextracted
Citation Alimardanov, ACuny, GDGrewal, GSLee, AMcKew, JCMohedas, AHShen, MXu, XYu, PB BMP inhibitors and methods of use thereof US Patent US9682983 Publication Date 6/20/2017
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase receptor R3
Name:Serine/threonine-protein kinase receptor R3
Synonyms:ACVRL1 | Activin receptor-like kinase 1 (ALK-1)
Type:Enzyme
Mol. Mass.:56134.46
Organism:Homo sapiens (Human)
Description:P37023
Residue:503
Sequence:
MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEG
RHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLA
LILGPVLALLALVALGVLGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDS
DCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWF
RETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLAL
RLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLGLAVMHSQGSD
YLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED
YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARL
TALRIKKTLQKISNSPEKPKVIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM161920
NameBDBM161920
Synonyms:US9682983, 52 | US9682983, 53
TypeSmall organic molecule
Emp. Form.C27H26N6
Mol. Mass.434.5355
SMILESC[C@H]1CNC[C@@H](C)N1c1ccc(cc1)-c1cnc2c(cnn2c1)-c1cccc2ncccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a