Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetbeta-Galactosidase (β-Gal)(R201C)
LigandBDBM228802
Substrate/Competitor4-Methylumbelliferyl-β-D-galactopyranoside
Meas. Tech.β-Gal Inhibitory Assay
pH4.5±n/a
Temperature310.15±n/a K
Ki 5.33e+4± 0 nM
Citation Suzuki, HOhto, UHigaki, KMena-Barragán, TAguilar-Moncayo, MOrtiz Mellet, CNanba, EGarcia Fernandez, JMSuzuki, YShimizu, T Structural basis of pharmacological chaperoning for human ß-galactosidase. J Biol Chem289:14560-8 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
beta-Galactosidase (β-Gal)(R201C)
Name:beta-Galactosidase (β-Gal)(R201C)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:73534.19
Organism:Homo sapiens (Human)
Description:Human β-Gal (24-677 aa) with R201C mutation
Residue:654
Sequence:
LRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTY
VPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKE
SILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLCFL
QKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGP
LINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSP
YAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLK
TVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRA
YVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYINDFKGLVSNLTLSS
NILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIP
DLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEW
APCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM228802
NameBDBM228802
Synonyms:5N,6S-(N'-butyliminomethylidene)-6-thio-1-deoxygalactonojirimycin | 6S-NBI-DGJ
TypeSmall organic molecule
Emp. Form.C11H20N2O3S
Mol. Mass.260.353
SMILESCCCC\N=C1/SC[C@@H]2[C@H](O)[C@H](O)[C@@H](O)CN12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
4-Methylumbelliferyl-β-D-galactopyranoside
NameBDBM50361738
Synonyms:CHEMBL1393422
TypeSmall organic molecule
Emp. Form.C16H18O8
Mol. Mass.338.3093
SMILESCc1cc(=O)oc2cc(O[C@@H]3O[C@H](CO)[C@H](O)[C@H](O)[C@H]3O)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: