Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOSBP-related protein 4 (ORP4L)
LigandBDBM20192
Substrate/Competitorn/a
Meas. Tech.Sterol-Binding Assay
pH7.4±n/a
Temperature293.15±n/a K
Kd 68±0.0 nM
Commentsextracted
Citation Charman, MColbourne, TRPietrangelo, AKreplak, LRidgway, ND Oxysterol-binding protein (OSBP)-related protein 4 (ORP4) is essential for cell proliferation and survival. J Biol Chem289:15705-17 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
OSBP-related protein 4 (ORP4L)
Name:OSBP-related protein 4 (ORP4L)
Synonyms:n/a
Type:Protein
Mol. Mass.:101264.66
Organism:Homo sapiens (Human)
Description:Q969R2
Residue:916
Sequence:
MGKAAAPSRGGGCGGRSRGLSSLFTVVPCLSCHTAAPGMSASTSGSGPEPKPQPQPVPEP
ERGPLSEQVSEAVSEAVPRSEPVSETTSEPEPGAGQPSELLQGSRPGSESSSGVGAGPFT
KAASEPLSRAVGSATFLRPESGSLPALKPLPLLRPGQAKTPLGVPMSGTGTTSSAPLALL
PLDSFEGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRGTINLSTAHIDTEDS
CGILLTSGARSYHLKASSEVDRQQWITALELAKAKAVRVMNTHSDDSGDDDEATTPADKS
ELHHTLKNLSLKLDDLSTCNDLIAKHGAALQRSLTELDGLKIPSESGEKLKVVNERATLF
RITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSA
PGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITVITEAKEDSRKAEGST
GTSSVDWSSADNVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPM
PVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFN
PMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISI
MPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPY
SYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTL
SAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTE
KQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGY
WEAKEKQDWHMCPNIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20192
NameBDBM20192
Synonyms:(1S,2R,5S,10S,11S,14R,15R)-2,15-dimethyl-14-[(2R)-6-methylheptan-2-yl]tetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadec-7-en-5-ol | cholesterol
TypeSteroid
Emp. Form.C27H46O
Mol. Mass.386.6535
SMILES[H][C@@]1(CC[C@@]2([H])[C@]3([H])CC=C4C[C@@H](O)CC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)CCCC(C)C |t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a