Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProkineticin 2 (PK2)
LigandBDBM121129
Substrate/Competitorn/a
Meas. Tech.Calcium Mobilization Assay
pH7.5±n/a
Temperature310.15±n/a K
IC50 40±0.0 nM
EC50 7.8±0 nM
Commentsextracted
Citation Chen, DNMa, YTLiu, HZhou, QYLi, JD Functional rescue of Kallmann syndrome-associated prokineticin receptor 2 (PKR2) mutants deficient in trafficking. J Biol Chem289:15518-26 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prokineticin 2 (PK2)
Name:Prokineticin 2 (PK2)
Synonyms:n/a
Type:Protein
Mol. Mass.:14333.75
Organism:Homo sapiens (Human)
Description:Q9HC23
Residue:129
Sequence:
MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTP
MGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSF
NRFICLAQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM121129
NameBDBM121129
Synonyms:A457 | US8722896, (+/-)-1-Benzyl-N-(9-chloro-3,4- dihydro-2H-1,5-benzodioxepin- 7-ylmethyl)-N- isobutylpyrrolidine-3- carboxamide
TypeSmall organic molecule
Emp. Form.C26H33ClN2O3
Mol. Mass.457.005
SMILESCC(C)CN(Cc1cc(Cl)c2OCCCOc2c1)C(=O)C1CCN(Cc2ccccc2)C1
Structure
n/a