Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM230656
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
IC50 6027±n/a nM
Citation Blaskovich, MACassidy, PJ Methods of modulating the activity of the MC5 receptor and treatment of conditions related to this receptor US Patent US9340517 Publication Date 5/17/2016
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor 5 (MC5R)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:36404.78
Organism:Macaca fascicularis (Cynomolgus monkey)
Description:G7PWB2
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPSVRNKSSPCENMGMAVEVFLALGAISLVENILVIGA
IVKNKNLHCPMYFFVCSLAVADMLVSMSNAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYPLRNHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFTMLFLLVSLYIHMFLLARTHAKRMAALPGASSARQRTSVQGAVTL
TMLLGVFIVCWAPFFLHLILMLSCPQNLYCSCFMSHFNMYLILIMCNSVVDPLIYAFRSR
EMRKTFKEIICCRGFRIACSCPGRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM230656
NameBDBM230656
Synonyms:US9340517, 105
TypeSmall organic molecule
Emp. Form.C35H40N6O2
Mol. Mass.576.7311
SMILESNC(=N)NCCC[C@H]1N[C@@H](CNC(=O)c2ccc3ccccc3c2)CCN(CC(c2ccccc2)c2ccccc2)C1=O
Structure
n/a