Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThiol:disulfide interchange protein (DsbA)
LigandBDBM231642
Substrate/Competitorn/a
Meas. Tech.Isothermal Titration Calorimetry (ITC)
pH7.4±0
Temperature298.15±0 K
Kd 7.9±1.7 nM
Citation Premkumar, LKurth, FDuprez, WGr°ftehauge, MKKing, GJHalili, MAHeras, BMartin, JL Structure of the Acinetobacter baumannii dithiol oxidase DsbA bound to elongation factor EF-Tu reveals a novel protein interaction site. J Biol Chem289:19869-80 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thiol:disulfide interchange protein (DsbA)
Name:Thiol:disulfide interchange protein (DsbA)
Synonyms:n/a
Type:Protein
Mol. Mass.:20315.10
Organism:Acinetobacter baumannii (AYE strain)
Description:A. baumannii DsbA lacking the predicted periplasmic leader sequence (27-205 aa)
Residue:179
Sequence:
AGKDYTVIANPGKVEVPGKIEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAM
NKVWEQGARTYYTSEALGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNS
TYNSFAVTAKVAESNKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM231642
NameBDBM231642
Synonyms:PSCGPGL
TypeSmall organic molecule
Emp. Form.C26H43N7O9S
Mol. Mass.629.726
SMILESCC(C)C[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1)C(O)=O |r|
Structure
n/a