Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAbelson tyrosine-kinase 1 SH2 domain (ABL SH2)
LigandBDBM231648
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarization Assay
pH7.25±n/a
Kd 3.27e+3± 7.4e+2 nM
Commentsextracted
Citation Gifford, SMLiu, WMader, CCHalo, TLMachida, KBoggon, TJKoleske, AJ Two amino acid residues confer different binding affinities of Abelson family kinase SRC homology 2 domains for phosphorylated cortactin. J Biol Chem289:19704-13 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Abelson tyrosine-kinase 1 SH2 domain (ABL SH2)
Name:Abelson tyrosine-kinase 1 SH2 domain (ABL SH2)
Synonyms:n/a
Type:Protein
Mol. Mass.:12162.87
Organism:Homo sapiens (Human)
Description:Truncated human ABL (131-238 aa)
Residue:108
Sequence:
PVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSES
RFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEME
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM231648
NameBDBM231648
Synonyms:SEPVpYETTE | pY466
TypeSmall organic molecule
Emp. Form.C45H68N9O23P
Mol. Mass.1134.0417
SMILESCC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](Cc1ccc(OP(O)(O)=O)cc1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a