Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phosphogluconate dehydrogenase (6PGD)
LigandBDBM94597
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
Ki 8300±1700 nM
IC50 8400±0.0 nM
Citation Akkemik, EBudak, HCiftci, M Effects of some drugs on human erythrocyte 6-phosphogluconate dehydrogenase: an in vitro study. J Enzyme Inhib Med Chem25:476-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-phosphogluconate dehydrogenase (6PGD)
Name:6-phosphogluconate dehydrogenase (6PGD)
Synonyms:6-phosphogluconate dehydrogenase
Type:Protein
Mol. Mass.:53143.42
Organism:Homo sapiens (Human)
Description:P52209
Residue:483
Sequence:
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM94597
NameBDBM94597
Synonyms:(Z)-2-butenedioate;10-(1-methyl-4-piperidinylidene)-5H-benzo[1,2]cyclohepta[3,4-b]thiophen-4-one | (Z)-but-2-enedioate;10-(1-methylpiperidin-4-ylidene)-5H-benzo[1,2]cyclohepta[3,4-b]thiophen-4-one | 10-(1-methyl-4-piperidylidene)-5H-benzo[1,2]cyclohepta[3,4-b]thiophen-4-one;maleate | KETOTIFEN FUMARATE | Ketotifen | Ketotifen fumarate | MLS002222254 | SMR001307257 | US9138431, KETOTIFEN | US9333199, KETOTIFEN | cid_45479747 | cid_5282408
TypeSmall organic molecule
Emp. Form.C19H19NOS
Mol. Mass.309.425
SMILES[#6]-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]-1/c2ccsc2-[#6](=O)-[#6]-c2ccccc-12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a