Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phosphogluconate dehydrogenase (6PGD)
LigandBDBM25902
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
Ki 127000±37800 nM
IC50 125000±0.0 nM
Citation Akkemik, EBudak, HCiftci, M Effects of some drugs on human erythrocyte 6-phosphogluconate dehydrogenase: an in vitro study. J Enzyme Inhib Med Chem25:476-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-phosphogluconate dehydrogenase (6PGD)
Name:6-phosphogluconate dehydrogenase (6PGD)
Synonyms:6-phosphogluconate dehydrogenase
Type:Protein
Mol. Mass.:53143.42
Organism:Homo sapiens (Human)
Description:P52209
Residue:483
Sequence:
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25902
NameBDBM25902
Synonyms:4-chloro-2-[(furan-2-ylmethyl)amino]-5-sulfamoylbenzoic acid | CHEMBL35 | Frusemide | Furanthril | Furosemide | Furosemide (3) | Furosemide, 4 | Lasix | US10172837, Furosemide
TypeSmall organic molecule
Emp. Form.C12H11ClN2O5S
Mol. Mass.330.744
SMILESNS(=O)(=O)c1cc(C(O)=O)c(NCc2ccco2)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a