Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phosphogluconate dehydrogenase (6PGD)
LigandBDBM48320
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
Ki 2111300±697900 nM
IC50 3270000±0.0 nM
Citation Akkemik, EBudak, HCiftci, M Effects of some drugs on human erythrocyte 6-phosphogluconate dehydrogenase: an in vitro study. J Enzyme Inhib Med Chem25:476-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-phosphogluconate dehydrogenase (6PGD)
Name:6-phosphogluconate dehydrogenase (6PGD)
Synonyms:6-phosphogluconate dehydrogenase
Type:Protein
Mol. Mass.:53143.42
Organism:Homo sapiens (Human)
Description:P52209
Residue:483
Sequence:
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM48320
NameBDBM48320
Synonyms:4-amino-5-chloro-N-[2-(diethylamino)ethyl]-2-methoxy-benzamide;hydrochloride | 4-amino-5-chloro-N-[2-(diethylamino)ethyl]-2-methoxybenzamide;hydrochloride | 4-azanyl-5-chloranyl-N-[2-(diethylamino)ethyl]-2-methoxy-benzamide;hydrochloride | METOCLOPRAMIDE | METOCLOPRAMIDE HYDROCHLORIDE | MLS000069667 | Metochloropramide | SMR000058471 | US9132134, Metoclopramide | cid_23659
TypeSmall organic molecule
Emp. Form.C14H22ClN3O2
Mol. Mass.299.796
SMILESCCN(CC)CCNC(=O)c1cc(Cl)c(N)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a