Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM234388
Substrate/Competitorn/a
Meas. Tech.Cell-Based Functional Assay (5-HT7)
IC50>10000±0 nM
Citation Nirogia, RVKambhampati, RDaulatabad, AVGudla, PShaikh, MAchanta, PKShinde, AKDubey, PK Design, synthesis and pharmacological evaluation of conformationally restricted N-arylsulfonyl-3-aminoalkoxy indoles as a potential 5-HT6 receptor ligands. J Enzyme Inhib Med Chem26:341-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-Hydroxytryptamine receptor 7 (5-HT7) | 5-hydroxytryptamine receptor 7 | 5-hydroxytryptamine receptor 7 (5-HT-7) | Adrenergic Alpha | GPRFO | HTR7 | Serotonin Receptor 7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:49852.62
Organism:Rattus norvegicus (rat)
Description:Rat cloned 5-HT7R.
Residue:448
Sequence:
MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVLQNSDHCGKKGHDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM234388
NameBDBM234388
Synonyms:3-Chloro-10-(2-N,N-Dimethylaminoethoxy)-5-Thia-4-b-azaindeno (8b)
TypeSmall organic molecule
Emp. Form.C18H17ClN2O3S
Mol. Mass.376.857
SMILESCN(C)CCOc1c2-c3ccccc3S(=O)(=O)n2c2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a