Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet-derived growth factor subunit B (PDGFB)
LigandBDBM234604
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
pH7.4±n/a
IC50>10000±n/a nM
Commentsextracted
Citation Boral, SMalone, TCWang, S Indole-1-carboxamides as kinase inhibitors US Patent US9353093 Publication Date 5/31/2016
More Info.:Get all data from this article,  Assay Method
 
Platelet-derived growth factor subunit B (PDGFB)
Name:Platelet-derived growth factor subunit B (PDGFB)
Synonyms:PDGF | Platelet-derived growth factor subunit B
Type:Enzyme
Mol. Mass.:27298.80
Organism:Homo sapiens (Human)
Description:P01127
Residue:241
Sequence:
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM234604
NameBDBM234604
Synonyms:US9353093, 33
TypeSmall organic molecule
Emp. Form.C21H16FN3O2S
Mol. Mass.393.434
SMILESCc1ccc(F)c(c1)C(=O)Nc1csc(c1)-c1cc2ccccc2n1C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a