Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetToll-like receptor 9 (TLR9)
LigandBDBM235716
Substrate/Competitorn/a
Meas. Tech.Antagonism Assay
Temperature310.15±n/a K
IC50 113±n/a nM
Commentsextracted
Citation Lipford, GBZepp, CM Immune system modulators US Patent US9359361 Publication Date 6/7/2016
More Info.:Get all data from this article,  Assay Method
 
Toll-like receptor 9 (TLR9)
Name:Toll-like receptor 9 (TLR9)
Synonyms:Toll-like receptor 9
Type:Enzyme
Mol. Mass.:115889.91
Organism:Homo sapiens (Human)
Description:Q9NR96
Residue:1032
Sequence:
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM235716
NameBDBM235716
Synonyms:US10117875, Example 57 | US9359361, 57
TypeSmall organic molecule
Emp. Form.C24H33N9
Mol. Mass.447.5791
SMILESCN1CCN(CCNc2nc(nc3nc(cnc23)N2CCN(C)CC2)-c2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a