Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM235768
Substrate/Competitorn/a
Meas. Tech.Reception Binding Assay
Temperature303.15±n/a K
Ki 246.86±n/a nM
IC50 370.3±n/a nM
Commentsextracted
Citation Liu, HXie, XZhen, XSun, HLi, JZhu, LLi, ZChen, YJiang, HChen, K Hexahydrodibenzo[a,g]quinolizine compound, preparation method thereof, pharmaceutical composition and use thereof US Patent US9359372 Publication Date 6/7/2016
More Info.:Get all data from this article,  Assay Method
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM235768
NameBDBM235768
Synonyms:US9359372, DC037003
TypeSmall organic molecule
Emp. Form.C21H25NO4
Mol. Mass.355.4275
SMILESCOc1ccc(OC)c2CN3CCc4cc(OC)c(OC)cc4C3Cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a