Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 3 (CA III)
LigandBDBM237284
Substrate/Competitorn/a
Meas. Tech.CA Activity Assay
Ki 1190±n/a nM
Citation Ekinci, DKurbanoglu, NISalamci, ESentürk, MSupuran, CT Carbonic anhydrase inhibitors: inhibition of human and bovine isoenzymes by benzenesulphonamides, cyclitols and phenolic compounds. J Enzyme Inhib Med Chem27:845-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 3 (CA III)
Name:Carbonic anhydrase 3 (CA III)
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 | Carbonic anhydrase III
Type:Enzyme
Mol. Mass.:29376.92
Organism:Bos taurus (Cattle)
Description:Q3SZX4
Residue:260
Sequence:
MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM237284
NameBDBM237284
Synonyms:Carbonic anhydrase inhibitors (CAIs), 7
TypeSmall organic molecule
Emp. Form.C6H12O2
Mol. Mass.116.1583
SMILESO[C@H]1CCCC[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a