Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetβ-lactamase (Bla2)
LigandBDBM50335803
Substrate/Competitorn/a
Meas. Tech.Slow-Binding Inhibition Assay
pH7±n/a
Ki 8.5e+4± 3.0e+4 nM
Commentsextracted
Citation Schlesinger, SRBruner, BFarmer, PJKim, SK Kinetic characterization of a slow-binding inhibitor of Bla2: thiomaltol. J Enzyme Inhib Med Chem28:137-42 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
β-lactamase (Bla2)
Name:β-lactamase (Bla2)
Synonyms:BAS3245 | Beta-lactamase II | GBAA_3500 | bla2
Type:Enzyme
Mol. Mass.:28177.23
Organism:Bacillus anthracis
Description:Q93T40
Residue:256
Sequence:
MKNTLLKLGVCVSLLGITPFVSTISSVQAERKVEHKVIKNETGTISISQLNKNVWVHTEL
GYFNGEAVPSNGLILNTSKGLVLVDSSWDDKLTKELIEMAEKKFKKSVTDVIITHAHADR
IGGIKTLKERGIKAHSTTLTAELAKKNGYEEPLGDLQAITKLKFGNMKVETFYPGKGHTE
DNIVVWLPQYNMLVGGCLVKSASAKDLGNITDAYVNEWSTSIENVLKRYENINFVVPGHG
EVGDKGLLLHTLDLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50335803
NameBDBM50335803
Synonyms:3-hydroxy-2-methyl-4H-pyran-4-thione | CHEMBL1650615 | Thiomaltol
TypeSmall organic molecule
Emp. Form.C6H6O2S
Mol. Mass.142.176
SMILESCc1occc(=S)c1O
Structure
n/a