Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMineralocorticoid receptor (MR)
LigandBDBM238162
Substrate/Competitorn/a
Meas. Tech.Binding Assay
pH7.5±n/a
IC50 4900±n/a nM
Commentsextracted
Citation O'Mahony, GKossenjans, MEdman, KKajanus, JHogner, KACornwall, PTurner, A Benzoxazinone amides as mineralocorticoid receptor modulators US Patent US9394291 Publication Date 7/19/2016
More Info.:Get all data from this article,  Assay Method
 
Mineralocorticoid receptor (MR)
Name:Mineralocorticoid receptor (MR)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:29747.25
Organism:Homo sapiens (Human)
Description:amino acids T729-K985
Residue:256
Sequence:
TISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLP
GFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYEL
CQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT
KCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQL
PKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM238162
NameBDBM238162
Synonyms:US9394291, 5b
TypeSmall organic molecule
Emp. Form.C19H16ClN3O5
Mol. Mass.401.8
SMILESNC(=O)C[C@@H]1COc2cc(Cl)ccc2N1C(=O)c1ccc2OCC(=O)Nc2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a