Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 4
LigandBDBM19461
Substrate/Competitorn/a
Meas. Tech.Esterase Activity Assay
pH7.4±n/a
Ki 1.12e+3± 0 nM
Commentsextracted
Citation Koz, ÿEkinci, DPerrone, APiacente, SAlankus-aliskan, ÿBedir, ESupuran, CT Analysis of saponins and phenolic compounds as inhibitors of a-carbonic anhydrase isoenzymes. J Enzyme Inhib Med Chem28:412-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 4
Name:Carbonic anhydrase 4
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV)
Type:Enzyme
Mol. Mass.:35037.98
Organism:Homo sapiens (human)
Description:P22748
Residue:312
Sequence:
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19461
NameBDBM19461
Synonyms:α-CA inhibitor, 5 | 5,7-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one | CHEMBL32571 | Naringenin | Naringenin (NAR) | naringetol | salipurpol
TypeEstrgen Antagonist
Emp. Form.C15H12O5
Mol. Mass.272.2528
SMILESOc1ccc(cc1)C1CC(=O)c2c(O)cc(O)cc2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a