Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEukaryotic elongation factor 2 kinase
LigandBDBM293935
Substrate/Competitorn/a
Meas. Tech.Kinase-Glo luminescent kinase assay
IC50 1000±n/a nM
Citation Dodd, JH Compounds inhibiting eukaryotic elongation factor 2 kinase activity US Patent US10106552 Publication Date 10/23/2018
More Info.:Get all data from this article,  Assay Method
 
Eukaryotic elongation factor 2 kinase
Name:Eukaryotic elongation factor 2 kinase
Synonyms:Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase | EEF2K | Eukaryotic elongation factor 2 kinase (EEF2K) | Eukaryotic elongation factor 2 kinase (eEF-2K) | eEF-2 kinase | eEF-2K
Type:Protein
Mol. Mass.:82116.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:725
Sequence:
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM293935
NameBDBM293935
Synonyms:US10106552, Compound 10
TypeSmall organic molecule
Emp. Form.C18H19N3O2S
Mol. Mass.341.427
SMILESCC1(C)CCc2c(C1)nc1sc(C(N)=O)c(N)c1c2-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a